You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
GNA13 Rabbit Polyclonal Antibody
Catalog Number: orb586481
| Catalog Number | orb586481 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GNA13 |
| Target | GNA13 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Guinea pig, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human GNA13 |
| Protein Sequence | Synthetic peptide located within the following region: GCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLK |
| UniProt ID | Q14344 |
| MW | 44kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | G13 |
| Note | For research use only |
| NCBI | NP_006563 |
| Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.
WB Suggested Anti-GNA13 Antibody, Titration: 1.0 ug/ml, Positive Control: COLO205 Whole Cell.
- Item 1 of 3
Anti-GNA13 Antibody [orb378077]
IF, IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 2
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
