You have no items in your shopping cart.
Cart summary
Item 1 of 1
Glp1r Rabbit Polyclonal Antibody
Catalog Number: orb331278
Product Properties
| Catalog Number | orb331278 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Glp1r |
| Target | Glp1r |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Human, Rabbit, Rat, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Mouse Glp1r |
| Protein Sequence | Synthetic peptide located within the following region: YRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLYIIYTV |
| UniProt ID | Q1JQR8 |
| MW | 51kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti GLP-1R antibody, anti GLP1Rc antibody |
| Note | For research use only |
| NCBI | NP_067307 |
Images
Sample Type: Mouse Liver lysates, Antibody dilution: 1.0 ug/ml.
Similar Products
- Item 1 of 7
GLP-1R Rabbit Polyclonal Antibody [orb10722]
IF, IHC-Fr, IHC-P, WB
Canine
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 3
- Item 1 of 2
- Item 1 of 2
- Item 1 of 2
Reviews
Glp1r Rabbit Polyclonal Antibody (orb331278)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review