GJE1 Rabbit Polyclonal Antibody

SKU: orb576040

Description

Rabbit polyclonal antibody to GJE1

Research Area

Epigenetics & Chromatin, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GJE1
• Target: GJC3
• Protein Sequence: Synthetic peptide located within the following region: KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
• Molecular Weight: 31kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CX29, GJE1, CX30.2, CX31.3

WB Suggested Anti-GJE1 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

GJC3

UniProt

Q8NFK1

RefSeq (Protein):NP_853516