GJB4 Rabbit Polyclonal Antibody

• Catalog Number: orb329879
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GJB4
• Target: GJB4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GJB4
• Protein Sequence: Synthetic peptide located within the following region: CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL
• UniProt ID: Q9NTQ9
• MW: 29kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti EKV antibody, anti CX30.3 antibody
• Research Area: Signal Transduction
• Note: For research use only
• NCBI: NP_694944

WB Suggested Anti-GJB4 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.