Git1 Rabbit Polyclonal Antibody

SKU: orb585025

Description

Git1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Git1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Rat Git1. This antibody reacts with Rat samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

• Tested Applications: WB
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Git1
• Target: Git1
• Protein Sequence: Synthetic peptide located within the following region: PLLSSSQEGSRHASKLSRHGSGAESDYENTQSGEPLLGLEGKRFLELSKE
• Molecular Weight: 84kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

Gene Symbol

Git1

UniProt

Q9Z272

RefSeq (Protein):NP_114002