You have no items in your shopping cart.
Cart summary
Item 1 of 1
GIMAP2 Rabbit Polyclonal Antibody
Catalog Number: orb583043
| Catalog Number | orb583043 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GIMAP2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human GIMAP2 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 37kDa |
| Target | GIMAP2 |
| UniProt ID | Q9UG22 |
| Protein Sequence | Synthetic peptide located within the following region: LVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYM |
| NCBI | NP_056475 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | IAN12, IMAP2, HIMAP2 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: Jurkat Whole cell lysates, Antibody dilution: 1.0 ug/ml.
- Item 1 of 3
GIMAP2 Rabbit Polyclonal Antibody [orb2253]
ICC, IF, IHC-Fr, IHC-P
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 3
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
