You have no items in your shopping cart.
Cart summary
Item 1 of 1
GHDC Rabbit Polyclonal Antibody
Catalog Number: orb585269
| Catalog Number | orb585269 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GHDC |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 52kDa |
| Target | GHDC |
| UniProt ID | B3KVB0 |
| Protein Sequence | Synthetic peptide located within the following region: LRWCLQGAQRPHCSLRRSTDISTFRNHLPLTKASQTQQEDSGEQPLPPTS |
| NCBI | NP_001136095 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | LGP1, D11LGP1 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-GHDC Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell.
- Item 1 of 2
GHDC Polyclonal Antibody [orb1416643]
IF, IHC-Fr, IHC-P, WB
Porcine, Rat
Rabbit
Polyclonal
Unconjugated
100 μl
