You have no items in your shopping cart.
GH2 Rabbit Polyclonal Antibody
SKU: orb330216
Description
Research Area
Disease Biomarkers, Signal Transduction
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Sheep |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GH2 |
| Target | GH2 |
| Protein Sequence | Synthetic peptide located within the following region: NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC |
| Molecular Weight | 22kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti GH-V antibody, anti GHL antibody, anti GHV antibody, anti hGH-V antibody
Similar Products
−- Item 1 of 2
GH2 Rabbit Polyclonal Antibody [orb627330]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg - Item 1 of 1
GH2 Rabbit Polyclonal Antibody [orb2955755]
ELISA, IHC, WB
Human, Monkey, Primate
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
WB Suggested Anti-GH2 Antibody Titration: 5.0 ug/mL, Positive Control: Human Placenta.
Documents Download
Datasheet
Product Information
Request a Document
GH2 Rabbit Polyclonal Antibody (orb330216)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1 - 2 weeks