You have no items in your shopping cart.
Cart summary
Item 1 of 1
GFRA4 Rabbit Polyclonal Antibody
Catalog Number: orb585058
| Catalog Number | orb585058 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GFRA4 |
| Target | GFRA4 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Sequence | Synthetic peptide located within the following region: RVAPWCDCGASGNRREDCEAFRGLFTRNRCLDGAIQAFASGWPPVLLDQL |
| UniProt ID | Q9GZZ7 |
| MW | 29kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_071422 |
WB Suggested Anti-GFRA4 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell. GFRA4 is supported by BioGPS gene expression data to be expressed in 721_B.
- Item 1 of 2
GFRA4 Rabbit Polyclonal Antibody [orb10710]
IF, IHC-Fr, IHC-P
Rat
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
