You have no items in your shopping cart.
Cart summary
Item 1 of 1
GDF15 antibody
Catalog Number: orb330226
| Catalog Number | orb330226 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GDF15 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GDF15 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 34kDa |
| Target | GDF15 |
| UniProt ID | Q99988 |
| Protein Sequence | Synthetic peptide located within the following region: ASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAP |
| NCBI | NP_004855 |
| Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti GDF-15 antibody, anti MIC-1 antibody, anti MI Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western blot analysis of PANC1 cell lysate tissue using GDF15 antibody
- Item 1 of 5
- Item 1 of 5
- Item 1 of 4
Anti-GDF15 / MIC1 Reference Antibody [orb1805630]
ELISA, FA, FACS, Kinetics
Human
Monoclonal
Unconjugated
5 mg, 1 mg, 100 μg, 50 μg - Item 1 of 3
GDF15 antibody [orb1289712]
IF, IH, IP, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 200 μl, 100 μl - Item 1 of 3
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars