GDF15 Rabbit Polyclonal Antibody

• Catalog Number: orb330226
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GDF15
• Target: GDF15
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GDF15
• Protein Sequence: Synthetic peptide located within the following region: ASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAP
• UniProt ID: Q99988
• MW: 34kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti GDF-15 antibody, anti MIC-1 antibody, anti MI
• Research Area: Disease Biomarkers, Signal Transduction
• Note: For research use only
• NCBI: NP_004855
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-GDF15 Antibody Titration: 0.2-1 ug/mL, Positive Control: PANC1 cell lysate, GDF15 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells.