Gcdh Rabbit Polyclonal Antibody

• Catalog Number: orb578871
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Gcdh
• Target: Gcdh
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
• Protein Sequence: Synthetic peptide located within the following region: LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV
• UniProt ID: D3ZT90
• MW: 49kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Gcdh
• Research Area: Epigenetics & Chromatin, Protein Biochemistry
• Note: For research use only
• NCBI: NP_001102366

WB Suggested Anti-Gcdh Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Brain.