GAS8 Rabbit Polyclonal Antibody

SKU: orb580254

Description

GAS8 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GAS8. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human GAS8. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GAS8
• Target: GAS8
• Protein Sequence: Synthetic peptide located within the following region: RALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKK
• Molecular Weight: 56kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

DRC4, GAS11, CILD33

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in both 56 kDa and 46 kDa isoforms.

Application: IHC, Species+tissue/cell type: Species+tissue/cell type: Human nasal epithelial cells, Primary antibody dilution: 1:1200, Secondary antibody: Goat anti-rabbit Alexa Fluor 546, Secondary antibody dilution: 1:1000.

WB Suggested Anti-GAS8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: THP-1 cell lysate.

Quick Database Links

Gene Symbol

GAS8

UniProt

O95995

RefSeq (Protein):NP_001472