GAS8 Rabbit Polyclonal Antibody

• Catalog Number: orb580254
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GAS8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GAS8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: GAS8
• UniProt ID: O95995
• Protein Sequence: Synthetic peptide located within the following region: RALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKK
• NCBI: NP_001472
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DRC4, GAS11, CILD33
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in both 56 kDa and 46 kDa isoforms.

Application: IHC, Species+tissue/cell type: Species+tissue/cell type: Human nasal epithelial cells, Primary antibody dilution: 1:1200, Secondary antibody: Goat anti-rabbit Alexa Fluor 546, Secondary antibody dilution: 1:1000.

WB Suggested Anti-GAS8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: THP-1 cell lysate.