GAS7 Rabbit Polyclonal Antibody

• Catalog Number: orb580204
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GAS7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Porcine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GAS7
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: GAS7
• UniProt ID: O60861
• Protein Sequence: Synthetic peptide located within the following region: SGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGW
• NCBI: NP_958839
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: KIAA0394, MGC1348, MLL/GAS7
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GAS7 is expressed in 721_B.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-GAS7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.