You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
GAS2L3 monoclonal antibody (M02), clone 1C8
Catalog Number: orb2290579
| Catalog Number | orb2290579 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant GAS2L3. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG1 Kappa |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | GAS2L3 (AAH43366, 595 a.a. ~ 694 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | SAFQKTGPSSLKSPGRTPLSIVSLPQSSTKTQTAPKSAQTVAKSQHSTKGPPRSGKTPASIRKPPSSVKDADSGDKKPTAKKKEDDDHYFVMTGSKKPRK |
| Tested applications | ELISA, IF, WB |
| Clone Number | 1C8 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | AAH43366 |
Immunofluorescence of monoclonal antibody to GAS2L3 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa).
