GAPDH Antibody

SKU: orb11605

Description

Goat polyclonal to GAPDH (glyceraldehyde 3-phosphate dehydrogenase). GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains.

Images & Validation

• Tested Applications: IF, IHC-Fr, IHC-P, WB
• Dilution range: WB:1:500-1:5,000, IF:1:50-1:250, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Fish, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.. Antigen Sequence: SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
• Target: Glyceraldehyde-3-phosphate dehydrogenase
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, G3PD, GAPD, HGNC:4141, GAPDH antibody.

Western blot analysis of 293 HEK cell lysate using GAPDH antibody

Immunofluorescence analysis of Hepa1-6 cells using GAPDH antibody at 1:50 dilution.

Quick Database Links

Gene Symbol

Glyceraldehyde-3-phosphate dehydrogenase