GAL3ST3 Rabbit Polyclonal Antibody

SKU: orb325554

Description

Rabbit polyclonal antibody to GAL3ST3

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GAL3ST3
• Target: GAL3ST3
• Protein Sequence: Synthetic peptide located within the following region: VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEP
• Molecular Weight: 49kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti GAL3ST-3 antibody, anti GAL3ST2 antibody, anti MGC142112 antibody, anti MGC142114 antibody

WB Suggested Anti-GAL3ST3 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Liver.

Quick Database Links

Gene Symbol

GAL3ST3

UniProt

Q96A11

RefSeq (Protein):NP_149025