GABRD Rabbit Polyclonal Antibody

• Catalog Number: orb592786
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GABRD
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Mouse, Rabbit
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABRD
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51kDa
• Target: GABRD
• UniProt ID: O14764
• Protein Sequence: Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG
• NCBI: NP_000806
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EJM7, EIG10, GEFSP5
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Fetal Kidney, Antibody Dilution: 1.0 ug/ml.

Human Muscle

Sample Type: Rat brain section, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-biotin, streptavidin-diaminobenzidine, Secondary Antibody Dilution: 1:500, Gene Name: GABRD.

WB Suggested Anti-GABRD Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.