GABRB3 Rabbit Polyclonal Antibody

SKU: orb329828

Description

Rabbit polyclonal antibody to GABRB3

Research Area

Cell Biology, Pharmacology & Drug Discovery, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GABRB3
• Target: GABRB3
• Protein Sequence: Synthetic peptide located within the following region: ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA
• Molecular Weight: 54 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti MGC9051 antibody, anti ECA5 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. In addition to the canonical 54 kDa isoform the peptide is present in a 58 kDa isoform and the protein is glycosylated.

Immunohistochemistry with Lung tissue at an antibody concentration of 5 ug/mL using anti-GABRB3 antibody (orb329828).

WB Suggested Anti-GABRB3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Liver.

Quick Database Links

Gene Symbol

GABRB3

UniProt

P28472

RefSeq (Protein):NP_068712