GABRA1 Rabbit Polyclonal Antibody

SKU: orb575336

Description

Rabbit polyclonal antibody to GABRA1

Research Area

Cell Biology, Pharmacology & Drug Discovery, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABRA1
• Target: GABRA1
• Protein Sequence: Synthetic peptide located within the following region: WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL
• Molecular Weight: 52kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

EJM, ECA4, EJM5, DEE19, EIEE19

GABRA1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb575336 with 1:200 dilution. Western blot was performed using orb575336 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: GABRA1 IP with orb575336 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-GABRA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

GABRA1

UniProt

P14867

RefSeq (Protein):NP_000797