GABPB2 Rabbit Polyclonal Antibody

SKU: orb329594

Description

GABPB2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GABPB1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human GABPB2. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GABPB2
• Target: GABPB1
• Protein Sequence: Synthetic peptide located within the following region: EPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKEQ
• Molecular Weight: 42kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti BABPB2 antibody, anti E4TF1 antibody, anti E4TF1-47 antibody, anti E4TF1-53 antibody, anti E4TF1B antibody, anti GABPB antibody, anti GABPB1 antibody, anti NRF2B1 antibody, anti NRF2B2 antibody, anti GABPB2 antibody

Quick Database Links

Gene Symbol

GABPB1

UniProt

Q06547

RefSeq (Protein):NP_005245