GABBR1 monoclonal antibody (M01), clone 2D7

• Catalog Number: orb2292929
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GABBR1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2D7
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: GABBR1 (AAH50532, 52 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG
• NCBI: AAH50532
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GABBR1 is approximately 0.3 ng/ml as a capture antibody.

GABBR1 monoclonal antibody (M01), clone 2D7 Western Blot analysis of GABBR1 expression in IMR-32.

Immunofluorescence of monoclonal antibody to GABBR1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of GABBR1 expression in transfected 293T cell line by GABBR1 monoclonal antibody (M01), clone 2D7. Lane 1: GABBR1 transfected lysate (95 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of GABBR1 over-expressed 293 cell line, cotransfected with GABBR1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GABBR1 monoclonal antibody (M01), clone 2D7 (Cat # orb2292929). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.63 KDa).