GAA Antibody

• Catalog Number: orb389407
• Category: Antibodies
• Description: GAA Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Western blot, 0.1-0.5μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 105324 MW
• UniProt ID: P10253
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Lysosomal alpha-glucosidase;3.2.1.20;Acid maltase;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of GAA using anti-GAA antibody.Lane 1:human A549 cell;2:human HepG2 cell;3:human HEK293 cell;4:human PC-3 cell.

IHC analysis of GAA using anti-GAA antibody. GAA was detected in paraffin-embedded section of human liver cancer tissues.

IHC analysis of GAA using anti-GAA antibody. GAA was detected in paraffin-embedded section of human prostatic cancer tissues.