GAA Antibody (monoclonal, 2G7)

• Catalog Number: orb623772
• Category: Antibodies
• Description: GAA Antibody (monoclonal, 2G7)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2G7
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human
• Isotype: Mouse IgG2b
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 110 kDa, 95 kDa, 76 kDa
• UniProt ID: P10253
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Lysosomal alpha-glucosidase;3.2.1.20
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
• Expiration Date: 12 months from date of receipt.

IF analysis of A549 cell using GAA antibody.

IF analysis of A549 cell using GAA antibody.

Immunohistochemical staining of human lung cancer tissue using GAA antibody.

Immunohistochemical staining of human mammary cancer tissue using GAA antibody.

Immunohistochemical staining of human prostatic cancer tissue using GAA antibody.

Western blot analysis of human A549 tissue lysates (Lane 1), human HEK293 whole cell lysates (Lane 2), human PC-3 whole cell lysates (Lane 3) using anti-GAA antibody

Flow Cytometry analysis of THP-1 cells using GAA antibody