FZD2 Rabbit Polyclonal Antibody

SKU: orb330164

Description

Rabbit polyclonal antibody to FZD2

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Pharmacology & Drug Discovery, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FZD2
• Target: FZD2
• Protein Sequence: Synthetic peptide located within the following region: MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI
• Molecular Weight: 63kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti Fz2 antibody, anti fz-2 antibody, anti fzE2 antibody, anti hFz2 antibody

Sample Tissue: Human HepG2, Human Jurkat, Human MCF7, Human DLD1, Human Hela, Human Fetal Liver, Human Stomach Tumor, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-FZD2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human Spleen.

Quick Database Links

Gene Symbol

FZD2

UniProt

Q14332

RefSeq (Protein):NP_001457