FXN purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2292962
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human FXN protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: FXN (AAH48097.1, 1 a.a. ~ 210 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
• NCBI: AAH48097.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

FXN MaxPab polyclonal antibody. Western Blot analysis of FXN expression in human liver.

Western Blot analysis of FXN expression in transfected 293T cell line by FXN MaxPab polyclonal antibody. Lane 1: FXN transfected lysate (23.1 KDa). Lane 2: Non-transfected lysate.