You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
FUT8 Rabbit Polyclonal Antibody
Catalog Number: orb584799
| Catalog Number | orb584799 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FUT8 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Reactivity | Human |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 47kDa |
| Target | FUT8 |
| UniProt ID | Q9BYC5 |
| Protein Sequence | Synthetic peptide located within the following region: LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR |
| NCBI | NP_004471 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | CDGF, CDGF1 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Positive control (+): Human Stomach Tumor (T-ST), Negative control (-): Human Liver Tumor (T-LI), Antibody concentration: 3 ug/ml.
WB Suggested Anti-FUT8 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Liver.
- Item 1 of 3
FUT8 Antibody (Center) [orb1938427]
IHC-P, WB
Mouse, Porcine, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 2
- Item 1 of 2
FUT8 Rabbit Polyclonal Antibody [orb100150]
IHC-P, WB
Canine, Equine, Gallus, Human, Rabbit
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 1
- Item 1 of 1
