FUBP3 Rabbit Polyclonal Antibody

• Catalog Number: orb581428
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FUBP3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FUBP3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 62kDa
• Target: FUBP3
• UniProt ID: Q96I24
• Protein Sequence: Synthetic peptide located within the following region: PSQQSQPQSSQPNYSKAWEDYYKKQSHAASAAPQASSPPDYTMAWAEYYR
• NCBI: NP_003925
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FBP3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Placenta

Human Placenta

Immunohistochemistry with Human Breast tissue at an antibody concentration of 5.0 ug/ml using anti-FUBP3 antibody (orb581428).

WB Suggested Anti-FUBP3 Antibody Titration: 1 ug/ml, Positive Control: THP-1 cell lysate.