CHES1 Rabbit Polyclonal Antibody

SKU: orb574411

Description

Rabbit polyclonal antibody to CHES1

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CHES1
• Target: FOXN3
• Protein Sequence: Synthetic peptide located within the following region: SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLL
• Molecular Weight: 52kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CHES1, PRO1635, C14orf116

WB Suggested Anti-CHES1 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate, FOXN3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

Quick Database Links

Gene Symbol

FOXN3

UniProt

O00409

RefSeq (Protein):NP_005188