FOXM1 monoclonal antibody (M09), clone 1D3

• Catalog Number: orb2293003
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant FOXM1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1D3
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: FOXM1 (NP_973731, 22 a.a. ~ 110 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILIS
• NCBI: NP_973731
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FOXM1 is 1 ng/ml as a capture antibody.

FOXM1 monoclonal antibody (M09), clone 1D3 Western Blot analysis of FOXM1 expression in Hela S3 NE.

Western Blot detection against Immunogen (35.53 KDa).