You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293006 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant FOXM1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2b Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | FOXM1 (NP_973731.1, 702 a.a. ~ 801 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | LQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ |
Tested applications | ELISA, IF, WB |
Clone Number | 5G10 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_973731.1 |
Detection limit for recombinant GST tagged FOXM1 is approximately 0.03 ng/ml as a capture antibody.
FOXM1 monoclonal antibody (M02), clone 5G10 Western Blot analysis of FOXM1 expression in PC-12.
FOXM1 monoclonal antibody (M02), clone 5G10. Western Blot analysis of FOXM1 expression in NIH/3T3.
Immunofluorescence of monoclonal antibody to FOXM1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa).