FOXA3 Rabbit Polyclonal Antibody

SKU: orb573978

Description

Rabbit polyclonal antibody to FOXA3

Research Area

Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXA3
• Target: FOXA3
• Protein Sequence: Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP
• Molecular Weight: 37kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FKHH3, HNF3G, TCF3G

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

Human Lung

WB Suggested Anti-FOXA3 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

FOXA3

UniProt

P55318

RefSeq (Protein):NP_004488