FNDC3B Rabbit Polyclonal Antibody

• Catalog Number: orb580844
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FNDC3B
• Target: FNDC3B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FNDC3B
• Protein Sequence: Synthetic peptide located within the following region: RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP
• UniProt ID: Q53EP0
• MW: 44kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: FAD104, PRO4979, YVTM2421
• Note: For research use only
• NCBI: EAW78473

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-FNDC3B Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate.