FN1 Rabbit Polyclonal Antibody

SKU: orb330186

Description

Rabbit polyclonal antibody to FN1

Research Area

Cell Biology, Disease Biomarkers, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FN1
• Target: FN1
• Protein Sequence: Synthetic peptide located within the following region: GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
• Molecular Weight: 71kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CIG antibody, anti DKFZp686F10164 antibody, anti DKFZp686H0342 antibody, anti DKFZp686I1370 antibody, anti DKFZp686O13149 antibody, anti FINC antibody, anti FN antibody, anti LETS antibody, anti MSF antibody, anti FNZ antibody, anti ED-B antibody, anti GFND antibody, anti GFND2 antibody

WB Suggested Anti-FN1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Thymus.

Quick Database Links

Gene Symbol

FN1

UniProt

Q564H7

RefSeq (Protein):NP_473375