FMN1 Rabbit Polyclonal Antibody

SKU: orb585154

Description

FMN1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of FMN1. It is suitable for IHC application. The immunogen is a synthetic peptide directed towards the following sequence ASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESHLENAQKSF. This antibody is predicted to react with Canine, Equine, Guinea pig, Human, Mouse, Rabbit. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Musculoskeletal & Connective Tissue Research

Images & Validation

• Tested Applications: IHC
• Predicted Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rabbit

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence ASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESHLENAQKSF
• Target: FMN1
• Protein Sequence: Synthetic peptide located within the following region: ASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESHLENAQKSF
• Molecular Weight: 158 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

LD, FMN

Quick Database Links

Gene Symbol

FMN1

UniProt

Q68DA7

RefSeq (Protein):NP_001096654