You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292986 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human FLT3LG protein. |
Clonality | Polyclonal |
Species/Host | Mouse |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | FLT3LG (NP_001450.2, 1 a.a. ~ 235 a.a) full-length human protein. |
Protein Sequence | MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH |
Tested applications | IF, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001450.2 |
Immunofluorescence of purified MaxPab antibody to FLT3LG on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of FLT3LG expression in transfected 293T cell line by FLT3LG MaxPab polyclonal antibody. Lane 1: FLT3LG transfected lysate (25.85 KDa). Lane 2: Non-transfected lysate.