FLI1 Rabbit Polyclonal Antibody

SKU: orb576523

Description

Rabbit polyclonal antibody to FLI1

Research Area

Cancer Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Porcine
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLI1
• Target: FLI1
• Protein Sequence: Synthetic peptide located within the following region: MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINP
• Molecular Weight: 51kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

EWSR2, SIC-1, BDPLT21

FLI1 antibody - N-terminal region (orb576523) validated by WB using porcine endothelial cell at 1:1000.

WB Suggested Anti-FLI1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate. FLI1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Quick Database Links

Gene Symbol

FLI1

UniProt

Q01543

RefSeq (Protein):NP_002008