Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

FKBP5 Rabbit Polyclonal Antibody

SKU: orb325933

Description

FKBP5 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of FKBP5. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP5. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human FKBP5
TargetFKBP5
Protein SequenceSynthetic peptide located within the following region: CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE
Molecular Weight51 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FKBP51 antibody, anti FKBP54 antibody, anti MGC111006 antibody, anti P54 antibody, anti PPIase antibody, anti Ptg-10 antibody, anti AIG6 antibody

Similar Products

  • FKBP5 Rabbit Polyclonal Antibody [orb627063]

    ELISA,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • FKBP5 Rabbit Polyclonal Antibody [orb325932]

    WB

    Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • FKBP51 Rabbit Polyclonal Antibody [orb156893]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Human, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • FKBP5 Rabbit Polyclonal Antibody [orb2952422]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • FKBP5 Rabbit Polyclonal Antibody [orb666691]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl, 30 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

FKBP5 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.

FKBP5 Rabbit Polyclonal Antibody

Brain, cortex.

FKBP5 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.

FKBP5 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.

FKBP5 Rabbit Polyclonal Antibody

WB Suggested Anti-FKBP5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004108

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

FKBP5 Rabbit Polyclonal Antibody (orb325933)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry