FKBP1A Rabbit Polyclonal Antibody

SKU: orb586177

Description

FKBP1A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting FKBP1A. It is suitable for WB and is reactive with human, mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: FKBP1A
• Protein Sequence: Synthetic peptide located within the following region: GQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSV
• Molecular Weight: 12kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FKBP1, PKC12, PKCI2, FKBP12, PPIASE, FKBP-12, FKBP-1A

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

WB Suggested Anti-FKBP1A Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell. FKBP1A is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Quick Database Links

Gene Symbol

FKBP1A

UniProt

P62942

RefSeq (Protein):NP_000792