You have no items in your shopping cart.
Cart summary
FimH Protein, Salmonella typhimurium, Recombinant (His & Myc)
Catalog Number: orb1976440
| Catalog Number | orb1976440 |
|---|---|
| Category | Proteins |
| Description | Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). A mannose-binding adhesin. FimH Protein, Salmonella typhimurium, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 41.2 kDa and the accession number is P37925. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| Protein Sequence | TVCRNSNGTATDIFYDLSDVFTSGNNQPGQVVTLPEKSGWVGVNATCPAGTTVNYTYRSYVSELPVQSTEGNFKYLKLNDYLLGAMSITDSVAGVFYPPRNYILMGVDYNVSQQKPFGVQDSKLVFKLKVIRPFINMVTIPRQTMFTVYVTTSTGDALSTPVYTISYSGKVEVPQNCEVNAGQVVEFDFGDIGASLFSQAGAGNRPQGVTPQTKTIAIKCTNVAAQAYLSMRLEAEKASGQAMVSDNPDLGFVVANSNGTPLTPNNLSSKIPFHLDDNAAARVGIRAWPISVTGIKPAEGPFTARGYLRVDYD |
| UniProt ID | P37925 |
| MW | 41.2 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Salmonella typhimurium |
| Biological Activity | Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). A mannose-binding adhesin. FimH Protein, Salmonella typhimurium, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 41.2 kDa and the accession number is P37925. |
| Expression Region | 23-335 aa |
| Storage | -20°C |
| Note | For research use only |
