Fibrinogen beta chain/FGB Antibody

• Catalog Number: orb389404
• Category: Antibodies
• Description: Fibrinogen beta chain/FGB Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 55928 MW
• UniProt ID: P02675
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Fibrinogen beta chain;Fibrinopeptide B;Fibrinogen
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HepG2 cells using anti-Fibrinogen beta chain/FGB antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

WB analysis of Fibrinogen beta chain/FGB using anti-Fibrinogen beta chain/FGB antibody.Lane 1:human HepG2 cell;2:rat kidney tissue;3:rat liver tissue;4:mouse kidney tissue;5:mouse liver tissue.

IF analysis of Fibrinogen beta chain/FGB using anti-Fibrinogen beta chain/FGB antibody. Fibrinogen beta chain/FGB was detected in an immunocytochemical section of A549 cells.