You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb692232 |
---|---|
Category | Antibodies |
Description | Fibrinogen beta chain/FGB Antibody (monoclonal, 6D12) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 6D12 |
Tested applications | IHC, WB |
Reactivity | Human |
Isotype | Mouse IgG2b |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.25-0.5μg/ml, Human Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 56 kDa |
UniProt ID | P02675 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Fibrinogen beta chain/FGB using anti-Fibrinogen beta chain/FGB antibody (orb692232). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human HEPG2 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Fibrinogen beta chain/FGB antigen affinity purified monoclonal antibody (Catalog # orb692232) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90502) with Tanon 5200 system. A specific band was detected for Fibrinogen beta chain/FGB at approximately 56KD. The expected band size for Fibrinogen beta chain/FGB is at 56KD.
IHC analysis of Fibrinogen beta chain/FGB using anti-Fibrinogen beta chain/FGB antibody (orb692232). Fibrinogen beta chain/FGB was detected in paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Fibrinogen beta chain/FGB Antibody (orb692232) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90443) with DAB as the chromogen.
IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating