FH Antibody

• Catalog Number: orb402491
• Category: Antibodies
• Description: FH Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, IHC-Fr, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 49 kDa
• UniProt ID: P07954
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Fumarate hydratase, mitochondrial; Fumarase; 4.2.1
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A431 cells using anti-FH antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of PC-3 cells using anti-FH antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of FH using anti-FH antibody.Lane 1:rat lymphaden tissue;2:rat small intestine tissue;3:rat gaster tissue;4:mouse kidney tissue;5:mouse testis tissue;6:mouse gaster tissue;7:human K562 cell;8:human U937 cell;9:human HL-60 cell.

IF analysis of FH using anti-FH antibody.FH was detected in immunocytochemical section of PC-3 cell.

IHC analysis of FH using anti-FH antibody.FH was detected in paraffin-embedded section of human colon cancer tissue.

IHC analysis of FH using anti-FH antibody.FH was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of FH using anti-FH antibody.FH was detected in paraffin-embedded section of human placenta tissue.

IHC analysis of FH using anti-FH antibody.FH was detected in paraffin-embedded section of mouse small intestine tissue.

IHC analysis of FH using anti-FH antibody.FH was detected in paraffin-embedded section of human mammary cancer tissue.