FH Antibody (monoclonal, 9D8)

• Catalog Number: orb507563
• Category: Antibodies
• Description: FH Antibody (monoclonal, 9D8)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 9D8
• Tested applications: ICC, IF, IHC, WB
• Reactivity: Human, Monkey, Mouse, Rat
• Isotype: Mouse IgG2a
• Immunogen: A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAH KNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 5 μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 48 kDa
• UniProt ID: P07954
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Fumarate hydratase, mitochondrial; Fumarase; FH;
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB analysis of FH using anti-FH antibody.Lane 1:K562 cell; 2:human placenta tissue; 3:COS-7 cell; 4:HL-60 cell; 5:Caco-2 cell; 6:U20S cell; 7:A549 cell.

WB analysis of FH using anti-FH antibody.Lane 1:rat thymus tissue; 2:rat testicular tissue; 3:rat stomach tissue; 4:mouse testicular tissue; 5:mouse kidney tissue; 6:NIH3T3 cell.

IHC analysis of FH using anti-FH antibody. FH was detected in paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of FH using anti-FH antibody. FH was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of FH using anti-FH antibody. FH was detected in paraffin-embedded section of rat liver tissue.