You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
FGFR1 monoclonal antibody (M15), clone 3C9
Catalog Number: orb2293052
| Catalog Number | orb2293052 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant FGFR1. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG2a Kappa |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | FGFR1 (NP_000595.1, 303 a.a. ~ 408 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | DNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDF |
| Tested applications | ELISA, WB |
| Clone Number | 3C9 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_000595.1 |
FGFR1 monoclonal antibody (M15), clone 3C9 Western Blot analysis of FGFR1 expression in U-2 OS.
Western Blot detection against Immunogen (37.4 KDa).
