FGFR1 monoclonal antibody (M03), clone 5E9

• Catalog Number: orb2293054
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FGFR1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5E9
• Tested applications: ELISA, PLA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: FGFR1 (AAH15035, 31 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMP
• NCBI: AAH15035
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FGFR1 is approximately 0.03 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between FGF1 and FGFR1. HeLa cells were stained with anti-FGF1 rabbit purified polyclonal 1:1200 and anti-FGFR1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of FGFR1 expression in transfected 293T cell line by FGFR1 monoclonal antibody (M03), clone 5E9. Lane 1: FGFR1 transfected lysate (92 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (38.83 KDa).