FGF8 monoclonal antibody (M06), clone 3H2

• Catalog Number: orb2293059
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant FGF8.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: FGF8 (NP_149354, 65 a.a. ~ 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK
• Tested applications: ELISA, WB
• Clone Number: 3H2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_149354

Detection limit for recombinant GST tagged FGF8 is approximately 0.3 ng/ml as a capture antibody.

FGF8 monoclonal antibody (M06), clone 3H2 Western Blot analysis of FGF8 expression in HepG2.