You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293060 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant FGF8. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | FGF8 (NP_149354, 65 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK |
Tested applications | ELISA, WB |
Clone Number | 2A10 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_149354 |
Detection limit for recombinant GST tagged FGF8 is approximately 0.3 ng/ml as a capture antibody.
FGF8 monoclonal antibody (M01), clone 2A10 Western Blot analysis of FGF8 expression in HepG2.
FGF8 monoclonal antibody (M01), clone 2A10. Western Blot analysis of FGF8 expression in Jurkat.
FGF8 monoclonal antibody (M01), clone 2A10. Western Blot analysis of FGF8 expression in NIH/3T3.
FGF8 monoclonal antibody (M01), clone 2A10. Western Blot analysis of FGF8 expression in PC-12.
FGF8 monoclonal antibody (M01), clone 2A10. Western Blot analysis of FGF8 expression in Raw 264.7.