You have no items in your shopping cart.
Cart summary
Item 1 of 1
FGF17 Rabbit Polyclonal Antibody
Catalog Number: orb585875
| Catalog Number | orb585875 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FGF17 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human FGF17 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 23kDa |
| Target | FGF17 |
| UniProt ID | O60258 |
| Protein Sequence | Synthetic peptide located within the following region: KLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVL |
| NCBI | NP_003858 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | HH20, FGF-13, FGF-17 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-FGF17 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell. FGF17 is supported by BioGPS gene expression data to be expressed in 721_B.
- Item 1 of 3
- Item 1 of 3
- Item 1 of 2
Anti-FGF17 Antibody [orb234842]
IH, WB
Human, Mouse, Primate, Rat, Sheep
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 1
- Item 1 of 1
Anti-FGF17 Antibody [orb1422922]
WB
Human, Mouse, Porcine, Rat, Virus
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl
