You have no items in your shopping cart.
Cart summary
Item 1 of 1
FETUB Rabbit Polyclonal Antibody
Catalog Number: orb578458
| Catalog Number | orb578458 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FETUB |
| Target | FETUB |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FETUB |
| Protein Sequence | Synthetic peptide located within the following region: GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL |
| UniProt ID | Q9UGM5 |
| MW | 42kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | 16G2, Gugu, IRL685 |
| Note | For research use only |
| NCBI | NP_055190 |
WB Suggested Anti-FETUB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Small Intestine.
- Item 1 of 2
FETUB Antibody [orb627011]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg - Item 1 of 1
- Item 1 of 1
