FCER2 monoclonal antibody (M03), clone S52

• Catalog Number: orb2293083
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant FCER2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: FCER2 (AAH14108, 1 a.a. ~ 321 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQGLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
• Tested applications: ELISA, IP, WB
• Clone Number: S52
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH14108

Immunoprecipitation of FCER2 transfected lysate using anti-FCER2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FCER2 MaxPab rabbit polyclonal antibody.

Western Blot analysis of FCER2 expression in transfected 293T cell line by FCER2 monoclonal antibody (M03), clone S52. Lane 1: FCER2 transfected lysate (36.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (61.05 KDa).