You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293083 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant FCER2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | FCER2 (AAH14108, 1 a.a. ~ 321 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQGLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
Tested applications | ELISA, IP, WB |
Clone Number | S52 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH14108 |
Immunoprecipitation of FCER2 transfected lysate using anti-FCER2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FCER2 MaxPab rabbit polyclonal antibody.
Western Blot analysis of FCER2 expression in transfected 293T cell line by FCER2 monoclonal antibody (M03), clone S52. Lane 1: FCER2 transfected lysate (36.5 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (61.05 KDa).